DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and VARS1

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_005249419.1 Gene:VARS1 / 7407 HGNCID:12651 Length:1265 Species:Homo sapiens


Alignment Length:273 Identity:55/273 - (20%)
Similarity:92/273 - (33%) Gaps:80/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NPQ---YAERYKELYRTLF---WLLLISVLANTAPITILPG----CPNRFYRLVHLSWM------ 71
            ||.   ...|.|::...|.   |.:....:|..|...:..|    .|....|..| :||      
Human   657 NPMVVPLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWH-AWMDNIREW 720

  Fly    72 ----ILWYG-----LFVL-------------GSYW---------------EFVLVTTQRVSLDRY 99
                .||:|     .||.             |.||               ||. |:..::||.:.
Human   721 CISRQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRNEAEAREKAAKEFG-VSPDKISLQQD 784

  Fly   100 LNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFA 164
            .:.::: .:...:|.:.:|.|.  |.:..|......:.|...:.|......|.:.|.|.|.|...
Human   785 EDVLDT-WFSSGLFPLSILGWP--NQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKLTGRLP 846

  Fly   165 CLAIFFNIWTHKFV--VYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERELTH 227
                |..::.|..|  .:...:|.:   :.|:|..:... |.:.|||:  ..:.|...|:.    
Human   847 ----FREVYLHAIVRDAHGRKMSKS---LGNVIDPLDVI-YGISLQGL--HNQLLNSNLDP---- 897

  Fly   228 LHSPRISEVQKIR 240
                  |||:|.:
Human   898 ------SEVEKAK 904

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 45/225 (20%)
VARS1XP_005249419.1 GST_C_ValRS_N 92..213 CDD:198327
PTZ00419 283..1265 CDD:240411 55/273 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.