DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and VARS1

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_005249419.1 Gene:VARS1 / 7407 HGNCID:12651 Length:1265 Species:Homo sapiens


Alignment Length:273 Identity:55/273 - (20%)
Similarity:92/273 - (33%) Gaps:80/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NPQ---YAERYKELYRTLF---WLLLISVLANTAPITILPG----CPNRFYRLVHLSWM------ 71
            ||.   ...|.|::...|.   |.:....:|..|...:..|    .|....|..| :||      
Human   657 NPMVVPLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWH-AWMDNIREW 720

  Fly    72 ----ILWYG-----LFVL-------------GSYW---------------EFVLVTTQRVSLDRY 99
                .||:|     .||.             |.||               ||. |:..::||.:.
Human   721 CISRQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRNEAEAREKAAKEFG-VSPDKISLQQD 784

  Fly   100 LNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFA 164
            .:.::: .:...:|.:.:|.|.  |.:..|......:.|...:.|......|.:.|.|.|.|...
Human   785 EDVLDT-WFSSGLFPLSILGWP--NQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKLTGRLP 846

  Fly   165 CLAIFFNIWTHKFV--VYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERELTH 227
                |..::.|..|  .:...:|.:   :.|:|..:... |.:.|||:  ..:.|...|:.    
Human   847 ----FREVYLHAIVRDAHGRKMSKS---LGNVIDPLDVI-YGISLQGL--HNQLLNSNLDP---- 897

  Fly   228 LHSPRISEVQKIR 240
                  |||:|.:
Human   898 ------SEVEKAK 904

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 45/225 (20%)
VARS1XP_005249419.1 GstA <56..203 CDD:223698
GST_C_ValRS_N 92..213 CDD:198327
PTZ00419 283..1265 CDD:240411 55/273 (20%)
ValRS_core 336..939 CDD:185677 55/273 (20%)
tRNA-synt_1_2 514..>610 CDD:290334
Anticodon_Ia_Val 939..1076 CDD:153416
Val_tRNA-synt_C 1197..1259 CDD:287436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.