DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gstt4

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:157 Identity:25/157 - (15%)
Similarity:55/157 - (35%) Gaps:74/157 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SIMLLTWQCR------NWAP------------------------------KLMTNIVTSD----- 137
            |:.:|.:.||      :|.|                              ||:..::|.:     
  Rat    67 SVAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTE 131

  Fly   138 -LNRAYTID-CNRT-----KRFIRLQLFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMP--- 192
             |::  |:| .|:.     ::|::.:||:.|....||              .::::...:.|   
  Rat   132 RLDK--TLDEVNKNIKQFEEKFLQDKLFITGDHISLA--------------DLVALVEMMQPMGT 180

  Fly   193 --NIISSISFAQYYLLLQ-----GIAW 212
              |:..|...|::.:.::     |:.|
  Rat   181 NHNVFISSKLAEWRMRVELAIGSGLFW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 25/157 (16%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 4/10 (40%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P30711 53..54
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P30711 66..67 25/157 (16%)
GST_C_Theta 92..216 CDD:198292 19/132 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.