DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gstz1

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:71 Identity:16/71 - (22%)
Similarity:27/71 - (38%) Gaps:14/71 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATKGAKLKNSPRERLSSFNPQYAERYKELYR------------TLFW-LLLISVLANTAPI-TIL 55
            |.||...:..|...:.....|::|.::.|..            |:.. |.::..|..|.|| .:|
  Rat    25 ALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITIGQSLAILEYLEETRPIPRLL 89

  Fly    56 PGCPNR 61
            |..|.:
  Rat    90 PQDPQK 95

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 0/1 (0%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 9/54 (17%)
maiA 7..211 CDD:273527 16/71 (23%)
Glutathione binding. /evidence=ECO:0000250 14..19