DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Eef1e1

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:77 Identity:16/77 - (20%)
Similarity:33/77 - (42%) Gaps:18/77 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TNIVTSDLNRAYTIDCNRTKRFIRLQLFLVG---IFACLAIFFNIWTHKFVVYRSILSINSYVMP 192
            |..:..||| :|..|          :::|.|   ..|.:.:::.:  |:|:|..::.....|:  
Mouse    91 TQTLLKDLN-SYLED----------KVYLAGHNITLADILLYYGL--HRFIVDLTVQEKEKYL-- 140

  Fly   193 NIISSISFAQYY 204
            |:.......|:|
Mouse   141 NVSRWFCHIQHY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 16/77 (21%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56
Linker. /evidence=ECO:0000250 57..63
C-terminal. /evidence=ECO:0000250 64..152 15/75 (20%)
GST_C_AIMP3 65..165 CDD:198338 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.