DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTT2B

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001074312.1 Gene:GSTT2B / 653689 HGNCID:33437 Length:244 Species:Homo sapiens


Alignment Length:87 Identity:18/87 - (20%)
Similarity:32/87 - (36%) Gaps:29/87 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VLANTAPITILPGC----PNRFY-------RLVHLSWMILWYGLFVLGSY----WEFVL------ 88
            :|..::.|.|...|    |:.:|       ..||  ..:.|:...:.|::    |..||      
Human    63 ILTESSAILIYLSCKYQTPDHWYPSDLQARARVH--EYLGWHADCIRGTFGIPLWVQVLGPLIGV 125

  Fly    89 ------VTTQRVSLDRYLNAIE 104
                  |...|.::|:.|..:|
Human   126 QVPEEKVERNRTAMDQALQWLE 147

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 13/67 (19%)
GSTT2BNP_001074312.1 GST_N_Theta 3..78 CDD:239348 4/14 (29%)
Glutathione binding 40..41
Glutathione binding 53..54