DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and eef1e1

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:73 Identity:15/73 - (20%)
Similarity:28/73 - (38%) Gaps:14/73 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IVTSDLNRAYTIDCNRTKRFIRLQLFLVG-IFACLAIFFNIWTHKFVVYRSILSINSYVMPNIIS 196
            ::..|||           |::..:::|.| :|....|......|..:|..:|.....|:  |:..
Zfish    91 VILKDLN-----------RYLEDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKECYL--NVSR 142

  Fly   197 SISFAQYY 204
            .....|:|
Zfish   143 WFDHIQHY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 15/73 (21%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 15/73 (21%)

Return to query results.
Submit another query.