DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GstD7

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:136 Identity:29/136 - (21%)
Similarity:48/136 - (35%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 PSMAD--FTKWV--CMLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTIT-H 345
            |::.|  |..|.  .:.::|....||..|.|:     .|:......:..|:.:....:.|.:| :
  Fly    56 PTLVDNGFVIWESRAIAVYLVEKYGKPDSPLY-----PNDPQKRALINQRLYFDMGTLYDALTKY 115

  Fly   346 FIIQMRT-NVRQHVVCGVINLDLKFLTTLL----------VASADFFIFLLQYDVTYEALSKSVQ 399
            |.:..|| ..........:|....||.|.|          :..||..|......|.:.:...|..
  Fly   116 FFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKF 180

  Fly   400 GNVTRY 405
            .||.|:
  Fly   181 PNVERW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 24/117 (21%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 5/20 (25%)
GstA 6..188 CDD:223698 29/136 (21%)
GST_C_Delta_Epsilon 92..206 CDD:198287 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.