DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GstD5

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:66 Identity:15/66 - (22%)
Similarity:20/66 - (30%) Gaps:31/66 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SFAQYYLLLQGIAWRQRRLTEGLERELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSILL 263
            |||:||.                  .|.|...|...|            || |.:..:|:|..:.
  Fly   107 SFAKYYY------------------PLFHTGKPGSDE------------DF-KKIESSFEYLNIF 140

  Fly   264 L 264
            |
  Fly   141 L 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 15/66 (23%)
GstD5NP_524914.3 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.