DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GstD3

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:61 Identity:16/61 - (26%)
Similarity:26/61 - (42%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 KAVNRTFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMAD--FTKWV--CMLLWLAMHVGK 307
            ||:...|...|:....|..:|.:.:.......|  |::.|  ||.|.  .:|::|....||
  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSI--PTLVDNGFTIWESRAILVYLVEKYGK 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 16/61 (26%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 14/55 (25%)
GST_C_Delta_Epsilon 72..188 CDD:198287
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.