DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GstD2

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:53 Identity:12/53 - (22%)
Similarity:22/53 - (41%) Gaps:18/53 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 FNIWTHKFVVYRSI--LSINSYVMPN------IISS----------ISFAQYY 204
            |:||..:.:....:  ...:.|::||      :|:.          .|||:||
  Fly    60 FSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 12/53 (23%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 3/13 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 6/25 (24%)

Return to query results.
Submit another query.