DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and LOC4577230

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_061498771.1 Gene:LOC4577230 / 4577230 VectorBaseID:AGAMI1_005589 Length:340 Species:Anopheles gambiae


Alignment Length:49 Identity:14/49 - (28%)
Similarity:20/49 - (40%) Gaps:10/49 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDL 138
            :|....||.|.|.|.....||.:|:         .|. ||..|::..|:
Mosquito    45 STAMPRLDLYYNIISPPCRVVLLFA---------KWL-KLELNLIELDV 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 14/49 (29%)
LOC4577230XP_061498771.1 None

Return to query results.
Submit another query.