DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and eEF1gamma

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_652000.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:43 Identity:14/43 - (32%)
Similarity:19/43 - (44%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 DLKFLTTLLVASADFFIF---LLQYDVTYEALSKSVQGNVTRY 405
            |..||....:..||..:|   |..|:...|...:|..|||.|:
  Fly   144 DATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 7/24 (29%)
eEF1gammaNP_652000.1 GST_N_EF1Bgamma 4..79 CDD:239342
GST_C_EF1Bgamma_like 90..209 CDD:198290 14/43 (33%)
EF1G 273..376 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.