DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr93a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:421 Identity:89/421 - (21%)
Similarity:166/421 - (39%) Gaps:94/421 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LYRTLFWLLLISVLANTAPITI---LPGCPNRFYRLVHLSW----MILWYGLF------VLG--- 81
            |||....||::|...:...:.:   ..|..|||   :|:.|    ::::.||:      |:|   
  Fly    24 LYRCARGLLVLSSSLDRDKLQLKATKQGSRNRF---LHILWRCIVVMIYAGLWPMLTSAVIGKRL 85

  Fly    82 -SYWEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNR---AY 142
             ||.: ||...|.:|              |.|.:::....|.|.      .|.....|||   .|
  Fly    86 ESYAD-VLALAQSMS--------------VSILAVISFVIQARG------ENQFREVLNRYLALY 129

  Fly   143 TIDCNRTKR----------FIRLQLF--LVGIF-ACLAIFFNIWTH----------KFVVYR--- 181
            ...|..|:.          |..|:||  |.|.| ..:.:|.|  :|          .|.:|.   
  Fly   130 QRICLTTRLRHLFPTKFVVFFLLKLFFTLCGCFHEIIPLFEN--SHFDDISQMVGTGFGIYMWLG 192

  Fly   182 SILSINSYVMPNIISSISFAQYYLLLQGIAWRQR-----------RLTEGLERELTHLHSPRISE 235
            ::..:::..:..::|.|.:.  ::....||..:|           |:|:....:|....:..:.|
  Fly   193 TLCVLDACFLGFLVSGILYE--HMANNIIAMLKRMEPIESQDERYRMTKYRRMQLLCDFADELDE 255

  Fly   236 VQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLW 300
            ...|   ::.|...|.:..|..|:.||...   :|||..:..::||.|.:....|...:|.:::.
  Fly   256 CAAI---YSELYHVTNSFRRILQWQILFYI---YLNFINICLMLYQYILHFLNDDEVVFVSIVMA 314

  Fly   301 LAMHVGKVCSILHFNQSI-QNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVIN 364
            .......|..::..:.:: |:|....|.|....|...:....::..|:.|::|...:..|.|..:
  Fly   315 FVKLANLVLLMMCADYTVRQSEVPKKLPLDIVCSDMDERWDKSVETFLGQLQTQRLEIKVLGFFH 379

  Fly   365 LDLKFLTTLLVASADFFIFLLQYDVT--YEA 393
            |:.:|:..:|.|...:...|:|:.:|  :||
  Fly   380 LNNEFILLILSAIISYLFILIQFGITGGFEA 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 78/381 (20%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 80/392 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.