DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GstZ1

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:91 Identity:19/91 - (20%)
Similarity:37/91 - (40%) Gaps:20/91 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 INSYVMPNIISSISFAQYYLLLQGIAWRQRRLT---EGLERELTHLHSP-------------RIS 234
            |.|.:.|  :.::|...:....|.:.|.|..::   :|||:.|:|....             .:.
  Fly   135 ICSGIQP--LQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVP 197

  Fly   235 EVQKIRMHHANLIDFTKAV--NRTFQ 258
            :|:..|.:.|:|..:...|  |:..|
  Fly   198 QVRNARRYKADLTPYPTIVRLNQELQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 19/91 (21%)
GstZ1NP_649894.1 maiA 35..240 CDD:273527 19/91 (21%)

Return to query results.
Submit another query.