DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr66a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster


Alignment Length:468 Identity:84/468 - (17%)
Similarity:151/468 - (32%) Gaps:165/468 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LSWMILWYGLF--VLGSYWEFVLVTTQRVSLDRYLNAIES------AIYVVHIFSIMLLTWQ--- 121
            ||.:||:..|:  ::.|:.|          .||.|.|.:|      .:::.:|..||:::.|   
  Fly    52 LSTLILYVVLYNILIYSFGE----------EDRSLKASQSTLTFVIGLFLTYIGLIMMVSDQLTA 106

  Fly   122 CRNWA--PKLMTNIVTSDLNRAYTIDC---NRT-KRFIRLQLFLVGIFACLAIFFNIWTHKFVVY 180
            .||..  .:|...|...| .|.|...|   |.| .|.||:.|.:..||. |:|..:.:. |.|.|
  Fly   107 LRNQGRIGELYERIRLVD-ERLYKEGCVMDNSTIGRRIRIMLIMTVIFE-LSILVSTYV-KLVDY 168

  Fly   181 RSILSINSYV--MPNIISSISFAQYYLLLQGIAWRQRRLTEGLEREL--TH-------------- 227
            ...:|:...|  :|..|:::....:.:.|..:..|...:...|| ||  ||              
  Fly   169 SQWMSLLWIVSAIPTFINTLDKIWFAVSLYALKERFEAINATLE-ELVDTHEKHKLWLRGNQEVP 232

  Fly   228 ----------------------------------------------------------------- 227
                                                                             
  Fly   233 PPLDSSQPPQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPP 297

  Fly   228 --------LHSPRISEVQKIR-------MHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLF 277
                    :|...:....|:.       ..|..:.:..||:|..:.|.||.|....||.|...|:
  Fly   298 PPPLATNMVHESELGNAAKVEEKLNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLY 362

  Fly   278 LVY------------QGIENPSMA----DFTKWVCMLL----WLAMHVGKVCSI-LHFNQSIQNE 321
            .:|            :..:||.:.    .:|...|:.|    |......|...| ||....:.::
  Fly   363 FLYCATQYQSIPSLFRSAKNPFITVIVLSYTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVADD 427

  Fly   322 HSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQ 386
            :.               :.:.:.|..:::..:......||...||::.|..:......:.|.|:|
  Fly   428 NL---------------LYEIVNHLSLKLLNHSVDFSACGFFTLDMETLYGVSGGITSYLIILIQ 477

  Fly   387 YDVTYEALSKSVQ 399
            :::..:...:::|
  Fly   478 FNLAAQQAKEAIQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 83/455 (18%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 82/454 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.