powered by:
Protein Alignment Gr59f and GstE12
DIOPT Version :9
Sequence 1: | NP_788432.1 |
Gene: | Gr59f / 37726 |
FlyBaseID: | FBgn0041234 |
Length: | 406 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246500.1 |
Gene: | GstE12 / 37960 |
FlyBaseID: | FBgn0027590 |
Length: | 223 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 18/73 - (24%) |
Similarity: | 32/73 - (43%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 317 SIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFL--TTLLVASAD 379
:|.:.|:.|..|:.: |.:|:.|......:.:...:.|.|:..|.:...|:|| ..|...|.|
Fly 64 TIIDSHAICAYLVEK--YGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTD 126
Fly 380 FFIFLLQY 387
..|..:.|
Fly 127 CSIDKIAY 134
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.