DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr58b

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster


Alignment Length:414 Identity:76/414 - (18%)
Similarity:135/414 - (32%) Gaps:154/414 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLV 160
            |.|.:|.:   .|...:|::|..|.:.|:....|....|    :|.|||           ..|.|
  Fly     6 LGRVMNVV---YYHSVVFALMSTTLRIRSCRKCLRLEKV----SRTYTI-----------YSFFV 52

  Fly   161 GIFACLAIFF---NIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLE 222
            |||..|.::|   .|....::.|..:|..|.:|| ..:.:|:....|    |..|.:|.....|.
  Fly    53 GIFLFLNLYFMVPRIMEDGYMKYNIVLQWNFFVM-LFLRAIAVVSCY----GTLWLKRHKIIQLY 112

  Fly   223 RELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVYQ--GIEN 285
            : .:.::..|...:.:..:....|:|..:::.|.....|:||: ..||...:   |.||  .:.|
  Fly   113 K-YSLIYWKRFGHITRAIVDKKELLDLQESLARIMIRKIILLY-SAFLCSTV---LQYQLLSVIN 172

  Fly   286 PS--------MADFTKWVCMLL------------WLAMHVGKVCSILHFN---------QSIQNE 321
            |.        :..|..::|:.:            :|.:|:  ..:.||..         :|:...
  Fly   173 PQIFLAFCARLTHFLHFLCVKMGFFGVLVLLNHQFLVIHL--AINALHGRKARKKWKALRSVAAM 235

  Fly   322 HSTCLTLLSR---------------------------VSYARKDI-------------------- 339
            |...|.|..|                           |.|:...|                    
  Fly   236 HLKTLRLARRIFDMFDIANATVFINMFMTAINILYHAVQYSNSSIKSNGWGILFGNGLIVFNFWG 300

  Fly   340 -----------------------------------QDTITHFIIQMRTNVRQHVVCGVINLD--- 366
                                               |..:..|.:|:|.|...:.:||::.||   
  Fly   301 TMALMEMLDSVVTSCNNTGQQLRQLSDLPKVGPKMQRELDVFTMQLRQNRLVYKICGIVELDKPA 365

  Fly   367 -LKFLTTLLVASADFFIFLLQYDV 389
             |.::.::|    ...|.|:|:|:
  Fly   366 CLSYIGSIL----SNVIILMQFDL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 75/411 (18%)
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 72/406 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.