DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr33a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:463 Identity:83/463 - (17%)
Similarity:142/463 - (30%) Gaps:176/463 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YRLVHLSWMILWYGLFVLGS--------------YWEFVLVTTQRVSL----------DRYLNAI 103
            |.|::||.:|   ||.:|.|              ...|:.:|...:||          |..||.|
  Fly    44 YLLINLSHII---GLCLLDSCNSVCKLSSHLFMHLGAFLYLTITLLSLYRRKEFFQQFDARLNDI 105

  Fly   104 ESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAI 168
            ::.|.            :|:..|......:.....:.||        .|..|.||.|..|   |:
  Fly   106 DAVIQ------------KCQRVAEMDKVKVTAVKHSVAY--------HFTWLFLFCVFTF---AL 147

  Fly   169 FFNIWTHKFVVYRSILSINSYV--MPNIISSISFAQYYLLLQGIAWRQRR---LTEGLERELTHL 228
            :::: ...::.:.::..|...|  .|.:..||...::...:..|:.|..:   |.|.:.:|..|.
  Fly   148 YYDV-RSLYLTFGNLAFIPFMVSSFPYLAGSIIQGEFIYHVSVISQRFEQINMLLEKINQEARHR 211

  Fly   229 HSPRI-----SEVQKIR------------------------------------------------ 240
            |:|..     ||.:|.|                                                
  Fly   212 HAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQQKNDDDDLDTSNDED 276

  Fly   241 -----------------MHHANLIDFTKAVNRTFQYSILL----------LFVGCF--------- 269
                             ...|||.|..|..::....|::.          ....||         
  Fly   277 EDDFDYDNATIAENTGNTSEANLPDLFKLHDKILALSVITNGEFGPQCVPYMAACFVVSIFGIFL 341

  Fly   270 ---LNF------NLVLFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVC--SILHFNQSIQNEHS 323
               :||      .|:.::.|.         :..|....:.:|..|.::|  :..|..||....|.
  Fly   342 ETKVNFIVGGKSRLLDYMTYL---------YVIWSFTTMMVAYIVLRLCCNANNHSKQSAMIVHE 397

  Fly   324 TC----LTLLSRVSYARKDIQDTITHFIIQMR--TNVRQHVVCGVINLDLKFLTTLLVASADFFI 382
            ..    ..:||...:..|     :..|.:|..  ....|....|:..||..|:.:.:.|:..:.|
  Fly   398 IMQKKPAFMLSNDLFYNK-----MKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAATSYLI 457

  Fly   383 FLLQYDVT 390
            .|||:|:|
  Fly   458 VLLQFDMT 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 81/459 (18%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 36/189 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.