DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr8a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:280 Identity:58/280 - (20%)
Similarity:113/280 - (40%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KRFIRLQLFLVGIFAC-LAIFFNIWTHKFVVYRSILSINSY---VMPNIISSISFAQYYLLLQGI 210
            ::|.|..:||..:.|. :||...:|..:.:....:|..::|   |....:.::.|..:..||   
  Fly   126 QQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELL--- 187

  Fly   211 AWRQRRLTEGLERELTHL--HSPRISE----------------VQKIRMHHANLIDFTKAVNRTF 257
               :.:|| |||||:..|  :|...||                |||.|: ::::.|..|.....|
  Fly   188 ---REQLT-GLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRI-YSHVYDMLKCFQGAF 247

  Fly   258 QYSILLLF--------VGCFLNFNLVLFLVYQGIEN-------PSMADFTKWV-----CMLLWLA 302
            .:|||.:.        |.|:..:    :.:|..:.|       |::.:...::     ||::   
  Fly   248 NFSILAVLLTINIRIAVDCYFMY----YSIYNNVINNDYYLIVPALLEIPAFIYASQSCMVV--- 305

  Fly   303 MHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDL 367
              |.::...||   :|..:...|         :..|:...|.:|.:|:.....:....|:..||.
  Fly   306 --VPRIAHQLH---NIVTDSGCC---------SCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDC 356

  Fly   368 KFLTTLLVASADFFIFLLQY 387
            ..||.:..:...:.|:.:|:
  Fly   357 SLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 58/280 (21%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 57/278 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.