DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr9a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:379 Identity:73/379 - (19%)
Similarity:142/379 - (37%) Gaps:115/379 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MILWYGLFVLGSY--------WE------------FVLVTTQRV---------------SLDRY- 99
            |.||...|:.|.:        |.            .||:..:.|               |:..| 
  Fly     1 MSLWLEHFLTGYFQLCGLVCGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDNESVPAYF 65

  Fly   100 ---LNAIESAIYVVHIFSIMLLTWQCRNW-------APKLMTNIVTSDLNRAYTIDCNRTKRFIR 154
               :..:..|..::|.:..:...::||.:       .|...|:.:               .|.:.
  Fly    66 AKVIMGVNMAYKMIHAWIALSALFECRRFRYLLEELPPVKATSFI---------------YRHLI 115

  Fly   155 LQLFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRR--- 216
            |::.|   |||.|         |:|. |..:|....:.|:       :|...||.:..|..:   
  Fly   116 LEIIL---FACNA---------FLVL-SEYTIRGIYLENL-------RYAYSLQAVRARYLQMMV 160

  Fly   217 LTEGLERELTHLHSPRI---SEVQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNF----NL 274
            |.:.|:.:|..||...|   |:.:.:|:.:|:|...|::::..|..|:|||.|.|..::    |:
  Fly   161 LVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNV 225

  Fly   275 VLFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDI 339
            ...:.|..:...::..|.:.:.::....:.:..:|:..|          .|::....:....||:
  Fly   226 YFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSICAASH----------RCVSKSKHLQQQLKDL 280

  Fly   340 -------QDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQ 386
                   :..|..|.:|:..:..|..|||:.:|:|:.|       |..|.|:|:
  Fly   281 PGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTL-------AGMFFFILE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 73/379 (19%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 70/373 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.