DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GSTZ1

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:134 Identity:26/134 - (19%)
Similarity:49/134 - (36%) Gaps:31/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATKGAKLKNSPRERLSSFNPQYAERYKEL----------------YRTLFWLLLISVLANTAPI- 52
            |.||...:..|...:.....|:::.::.|                :::   |.:|..|....|. 
Human    26 ALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQS---LAIIEYLEEMRPTP 87

  Fly    53 TILPGCPNRFYRLVHLSWMIL-----WYGLFVLGSYWEFVLVTTQRVSLDRYLNAIE------SA 106
            .:||..|.:...:..:|.:|.     ...|.||....|.:.:|..:.::....||:|      :.
Human    88 RLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAG 152

  Fly   107 IYVV 110
            ||.|
Human   153 IYCV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 13/61 (21%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 26/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.