DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GstE9

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:36 Identity:12/36 - (33%)
Similarity:19/36 - (52%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 FTKA-VNRTFQYSILLLFVGCFLNFNLVLFLVYQGI 283
            |.:| |::...:...:||.||..|..:.||  |:.|
  Fly    91 FKRALVDQRLHFESGVLFQGCIRNIAIPLF--YKNI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 12/36 (33%)
GstE9NP_725784.1 GstA 4..199 CDD:440390 12/36 (33%)

Return to query results.
Submit another query.