DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and GstT2

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:257 Identity:45/257 - (17%)
Similarity:71/257 - (27%) Gaps:120/257 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GAKLKNSPRE----RLSSFNPQYAERYKELYRTLFWLLLISVLANTAPITILPGCPNRFYRL--- 65
            |.|..|||.|    .|..|. |..:.||::                          |||.::   
  Fly    22 GLKFSNSPVEYCPIALRKFE-QLTDEYKKI--------------------------NRFQKVPAI 59

  Fly    66 ----VHLSWMILWYGLFVLGSYWEFVLVTTQRVSLDRYL---NAIESAIYVVHIFSIMLLTWQCR 123
                .|||                      :.:::.|||   ...:..:|               
  Fly    60 VGGDFHLS----------------------ETIAIIRYLADKGQFDEKLY--------------- 87

  Fly   124 NWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWTHKFVVYRSILSINS 188
               ||.:.       |||      |...|:..|...:.: ||...|.:.|.              
  Fly    88 ---PKTLE-------NRA------RVDEFLEWQHLNIRL-ACSMYFRDAWL-------------- 121

  Fly   189 YVMPNIISSISFAQYYLLLQGI---------AWRQRRLTEGLERELTHLHSPRISEVQKIRM 241
            :.|..|.......|...|::|:         .|.:.....|  :.||.......||:.::|:
  Fly   122 FPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVG--KNLTMADILGSSEINQLRL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 33/200 (17%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 20/106 (19%)
GstA 7..202 CDD:223698 45/257 (18%)
GST_C_family 93..218 CDD:295467 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.