DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and eef1g

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:159 Identity:39/159 - (24%)
Similarity:53/159 - (33%) Gaps:50/159 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IISSISFAQYYLLLQGIAWRQRRLTEGL---ERELTHLHSPRISEVQKIRMHHANLIDFTKAVNR 255
            ::..:|||...::....||....|  |:   .::.|......:..|..:...|.|        .|
Zfish    95 VLQWVSFADSEVIPPASAWVFPTL--GIMQFNKQATEQAKEEVKRVLAVLNQHLN--------TR 149

  Fly   256 TFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQN 320
            ||       .||                |..|:||.|. ||.||||...|.:    |.|.|...|
Zfish   150 TF-------LVG----------------ERISLADITV-VCSLLWLYKQVLE----LAFRQPYPN 186

  Fly   321 E---HSTCL------TLLSRVSYARKDIQ 340
            .   ..||:      |:|..|....|..|
Zfish   187 VTRWFVTCVNQPQFKTVLGEVKLCEKMAQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 39/159 (25%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342
maiA 5..201 CDD:273527 34/143 (24%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 37/155 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.