DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and EEF1G

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens


Alignment Length:210 Identity:42/210 - (20%)
Similarity:68/210 - (32%) Gaps:75/210 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NRTKRFIRLQLFLVG------------IFACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSIS 199
            |||..|:|  .|..|            :|...||.:      :|....:..........::..:|
Human    44 NRTPEFLR--KFPAGKVPAFEGDDGFCVFESNAIAY------YVSNEELRGSTPEAAAQVVQWVS 100

  Fly   200 FAQYYLLLQGIAW---------RQRRLTEGLERELTHLHSPRISEVQKIRMHHANLID-FTKAVN 254
            ||...::.....|         ..::.||..:.|:..:               ..|:| :.|  .
Human   101 FADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRI---------------LGLLDAYLK--T 148

  Fly   255 RTFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQ 319
            |||       .||                |..::||.|. ||.||||...|.:.    .|.|:..
Human   149 RTF-------LVG----------------ERVTLADITV-VCTLLWLYKQVLEP----SFRQAFP 185

  Fly   320 NEHSTCLTLLSRVSY 334
            |.:...||.:::..:
Human   186 NTNRWFLTCINQPQF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 42/210 (20%)
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 11/45 (24%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/155 (20%)
tolA <212..>278 CDD:236545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.