DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr59c

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_726292.1 Gene:Gr59c / 192481 FlyBaseID:FBgn0041235 Length:397 Species:Drosophila melanogaster


Alignment Length:373 Identity:67/373 - (17%)
Similarity:141/373 - (37%) Gaps:68/373 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YRLVHLSWMILWYGLFVLGS---YWEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQCRN 124
            |..||.:.:|....||.||:   ..||:...    .|..|...:.:|:.:..:...::..|..|:
  Fly    42 YAAVHNASLITLLILFNLGNNSLKSEFISAR----YLHEYFFMLMTAVRISAVLLSLITRWYQRS 102

  Fly   125 WAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNI----------WTHKFVV 179
            ...::...|:....:|...:    ..|:.|..:.|..:|..|:...:.          .|...:|
  Fly   103 RFIRIWNQILALVRDRPQVV----RGRWYRRSIILKFVFCVLSDSLHTISDVSAQRKRITADLIV 163

  Fly   180 YRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLE---RELTHLHSPR--------- 232
            ..|:|:..:.:...|:     .||||.:..:....:.|.:.|.   |:...:.|.|         
  Fly   164 KLSLLATLTTIFNMIV-----CQYYLAMVQVIGLYKILLQDLRCLVRQAECICSIRNRRGGVYSI 223

  Fly   233 -----ISEVQKIRMHHANLIDFTKAVNRTFQ-YSILLLFVGCFLNFNLVLFLVYQGIENPSMADF 291
                 ..::..|...|..|.|....::..|| .|:.:..|..|.....:.|.|...:.:.:....
  Fly   224 QCCSLADQLDLIAERHYFLKDRLDEMSDLFQIQSLSMSLVYFFSTMGSIYFSVCSILYSSTGFGS 288

  Fly   292 TKWVCMLL-----------WLAMHVGKVCSILHFNQSIQNEHSTCLTLLS-RVSYARK---DIQD 341
            |.|..:|:           ||::::|     .|    |:::......:|: |..:.|:   .::.
  Fly   289 TYWGLLLIVLSTASFYMDNWLSVNIG-----FH----IRDQQDELFRVLADRTLFYRELDNRLEA 344

  Fly   342 TITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQYDV 389
            ...:|.:|:.:|..:..|.|:..::...|..:|.:.....:.|:|:::
  Fly   345 AFENFQLQLASNRHEFYVMGLFKMERGRLIAMLSSVITHTMVLVQWEI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 67/370 (18%)
Gr59cNP_726292.1 7tm_7 9..394 CDD:285581 67/373 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.