DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Y53G8B.1

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:49 Identity:15/49 - (30%)
Similarity:23/49 - (46%) Gaps:11/49 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 NIISSISFAQ---YYLLLQ------GIAWRQRRLTEGLE--RELTHLHS 230
            :|.|:|...|   .||:|.      |..|.|..:::|.:  .||..:||
 Worm   101 HIASNIQPLQNKPIYLMLNEKEPGYGDFWCQHFISKGFKALEELLQMHS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 15/49 (31%)
Y53G8B.1NP_497662.1 maiA 18..211 CDD:273527 15/49 (31%)

Return to query results.
Submit another query.