DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gstz1

DIOPT Version :10

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:71 Identity:15/71 - (21%)
Similarity:25/71 - (35%) Gaps:14/71 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATKGAKLKNSPRERLSSFNPQYAERYKEL-------------YRTLFWLLLISVLANTAPI-TIL 55
            |.||...:..|...:.....|:.|.::.|             ...:..|.::..|..|.|| .:|
Mouse    25 ALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYLEETRPIPRLL 89

  Fly    56 PGCPNR 61
            |..|.:
Mouse    90 PQDPQK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 0/1 (0%)
Gstz1NP_034493.1 maiA 7..211 CDD:273527 15/71 (21%)

Return to query results.
Submit another query.