DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gstt1

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:137 Identity:26/137 - (18%)
Similarity:49/137 - (35%) Gaps:28/137 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVT---SDLNRAYTIDCNRTKRFIRLQL 157
            |:.||:.:......::||:       .:|..|..|..:..   ..|:.|:.    |.....|:..
Mouse     3 LELYLDLLSQPCRAIYIFA-------KKNNIPFQMHTVELRKGEHLSDAFA----RVNPMKRVPA 56

  Fly   158 FLVGIFA-CLAIFFNIW-THKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEG 220
            .:.|.|. |.::...:: .||:       .:..:..|..:.:.:....||     ||:...|...
Mouse    57 MMDGGFTLCESVAILLYLAHKY-------KVPDHWYPQDLQARARVDEYL-----AWQHTGLRRS 109

  Fly   221 LERELTH 227
            ..|.|.|
Mouse   110 CLRALWH 116

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 26/137 (19%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 26/137 (19%)
GST_N_Theta 3..78 CDD:239348 16/85 (19%)