DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr22d

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster


Alignment Length:418 Identity:87/418 - (20%)
Similarity:168/418 - (40%) Gaps:87/418 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FNPQYAERYKELYRTLFWLLLISVLANTAPITILPGCPNRFYRLVHLSWMILWYGLFVLGSYWEF 86
            |.|:...|.|.:|..|..:|..|.|....|....|    :..||....|:|| :|:.:..|.  .
  Fly     2 FRPRCGLRQKFVYVILKSILYSSWLLGIFPFKYEP----KKRRLRRSMWLIL-FGVVISSSL--L 59

  Fly    87 VLVTTQR-------VSLDRY--------LNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTS 136
            :|:..|.       :.||.:        ::::...:.||.|.::.|.|.    |..|.:..|...
  Fly    60 ILMVKQSAEDREHGIMLDVFQRNALLYQISSLMGVVGVVSICTVHLRTL----WRSKHLEEIYNG 120

  Fly   137 --DLNRAY----TIDCNRTKRFIRLQ---LFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMP 192
              .|...|    .::|.....:: :|   :.:||:.|...:.|.:...|..|. ::|.::...:.
  Fly   121 LMLLEAKYFCSNAVECPAFDGYV-IQKGVVIVVGLLAPWMVHFGMPDSKLPVL-NVLVVSMVKLG 183

  Fly   193 NIISSISFAQYYLLLQGIAWRQRRLTEGLERELTHLHSPRISEVQKIRMHHAN--------LIDF 249
            .::.::.:....:::....|.       :.|||       :|.|..:|.:|..        |..:
  Fly   184 TLLLALHYHLGVVIIYRFVWL-------INREL-------LSLVCSLRGNHKGSSSRVRFLLKLY 234

  Fly   250 TKAVNRTFQYSIL--------LLFVGCFLNFNLVL--FLVYQGIENPSMADFTKWVC-------- 296
            .|.||   .||.|        :|.:..||..|:::  :::...|....|:.|...:.        
  Fly   235 NKLVN---LYSKLADCYDCQTVLMMAIFLAANIIVCFYMIVYRISLSKMSFFVMLIMFPLAIANN 296

  Fly   297 -MLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVC 360
             |..||:|   |||.:|   |....:.|..|.|.:.:....||::.:|:.|.:.......:.:.|
  Fly   297 FMDFWLSM---KVCDLL---QKTGRQTSMILKLFNDIENMDKDLEISISDFALYCSHRRFKFLHC 355

  Fly   361 GVINLDLKFLTTLLVASADFFIFLLQYD 388
            |:.:::.:....:.|||..:.::|:|:|
  Fly   356 GLFHVNREMGFKMFVASVLYLLYLVQFD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 75/377 (20%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 82/403 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.