DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr10a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:443 Identity:94/443 - (21%)
Similarity:165/443 - (37%) Gaps:110/443 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPRERLSSFNPQYAE--RYKELYRTLFWLLLISVLANTAPITILPGCPNRFYRLVHLSWMILWYG 76
            ||.||.|.:.....:  ||..:|..::..::|..:...|   :..|.........||..|:|   
  Fly     3 SPDERKSFWERHEFKFYRYGHVYALIYGQVVIDYVPQRA---LKRGVKVLLIAYGHLFSMLL--- 61

  Fly    77 LFVLGSY--WEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLN 139
            :.||..|  :.|..:|.   :|||.|..:   .||           ...|.|.|..|.|||...|
  Fly    62 IVVLPGYFCYHFRTLTD---TLDRRLQLL---FYV-----------SFTNTAIKYATVIVTYVAN 109

  Fly   140 RAYTIDCN------RTK----------------------RFIRLQLFLV----GIFACLAIFFNI 172
            ..:....|      ||.                      :|..:.|.::    |||   |.:..:
  Fly   110 TVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQVCGIF---AQYGEV 171

  Fly   173 WTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIA---WRQRRLTEGLERE---------- 224
            ........|...:|.::|:.|...::  |.|...:.|..   :||..|..|..|:          
  Fly   172 GKGSVSQVRVHFAIYAFVLWNYTENM--ADYCYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGGM 234

  Fly   225 LTHLHSPRISE-VQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLN-----FNLVLFLVYQGI 283
            |.| |...:|: ::::|.....:.|..:...|..|:.::.|.:...:|     :.|...|..|.:
  Fly   235 LLH-HCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSL 298

  Fly   284 ENPSMADFTKWVCMLLWLAMHVGKVCS----ILHFNQSIQNEH------STCLTLLSRVSYARKD 338
            |..|             ..:.||.|.:    |..:..::.|||      :..||:.........|
  Fly   299 EEVS-------------YPVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTMRRFAEPREMD 350

  Fly   339 IQDT--ITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQYDV 389
            .:.|  |.|..::: .|.:..::||:::||.:.:..:.|.:..:||.|:|:|:
  Fly   351 ERLTREIEHLSLEL-LNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLVQFDL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 82/391 (21%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 88/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.