DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr28b

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:427 Identity:83/427 - (19%)
Similarity:156/427 - (36%) Gaps:124/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KELYRTLF----WLLLISVLANTAPITILPGC---PNRFYRLVHLSWMILWYG---LFVLGSYWE 85
            |.:.:|:|    .::.|::......:||...|   .:.|:|.     .|.::|   ..|.|    
  Fly    71 KAIKKTIFGYINGIMHIAMFVFAYSLTIYNNCESVASYFFRS-----RITYFGDLMQIVSG---- 126

  Fly    86 FVLVTTQRVSLDRYLNA------IESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTI 144
            |:.||.      .||.|      :|..:...|...:.|.|...:....|::              
  Fly   127 FIGVTV------IYLTAFVPNHRLERCLQKFHTMDVQLQTVGVKIMYSKVL-------------- 171

  Fly   145 DCNRTKRFIRLQLFLV------GIFACL---------AIFFNIWTHKFVVYRSILSINSYVMPNI 194
               |....:.:.:|||      |.|:.|         |:.|.     |::..::::|       .
  Fly   172 ---RFSYMVLISMFLVNVLFTGGTFSVLYSSEVAPTMALHFT-----FLIQHTVIAI-------A 221

  Fly   195 ISSISFAQYYL---------LLQGIA--WRQRRL--TEGLERELTHLHS----------PRISEV 236
            |:..|...|.:         :|:.:|  |..|.|  ....:|.|..|.|          |.....
  Fly   222 IALFSCFTYLVEMRLVMVNKVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMYTIVTKDPAEIIQ 286

  Fly   237 QKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVYQGIEN-----------PSMAD 290
            :.:.:||. :.:.....|:.|.|.:|.:....||   :::|..|..:|.           .::..
  Fly   287 ESMEIHHL-ICEAAATANKYFTYQLLTIISIAFL---IIVFDAYYVLETLLGKSKRESKFKTVEF 347

  Fly   291 FTKWVC-MLLWLAMHVGKVCSILH-FNQSIQNEHST---CLTLLSRVSYARKDIQDTITHFIIQM 350
            .|.:.| |:|:|.    .:.||:. .|::|:....|   ..:||::...|  ::::.:..|.:|:
  Fly   348 VTFFSCQMILYLI----AIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSA--EVKEKLQQFSMQL 406

  Fly   351 RTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQY 387
            ..........|:.|:|.....|:..|...:.|.|||:
  Fly   407 MHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 76/390 (19%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 82/425 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.