DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr22b

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:401 Identity:70/401 - (17%)
Similarity:153/401 - (38%) Gaps:80/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LYRTLF--WLLLISVLANTAPITILPGCPNRFYRLVHLSWMILWYGLFVLGSYWEFVLVTT---- 91
            |..||:  |||.|      .|.|:..|   :..|.:..|..:..||| ||..:..|.|:..    
  Fly    17 LKTTLYGSWLLGI------FPFTLDSG---KRIRQLRRSRCLTLYGL-VLNYFLIFTLIRLAFEY 71

  Fly    92 QRVSLDRY-----LNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYT-------I 144
            ::..|:.:     |..|...|.::::.|.:::.:. ..|..:.:..|....|...|.       .
  Fly    72 RKHKLEAFKRNPVLEMINVVIGIINVLSALIVHFM-NFWGSRKVGEICNELLILEYQDFEGLNGR 135

  Fly   145 DCNRTKRFIRLQLFLVGIFACLAI---FFNIWTHKFVV----YRSILSINSYVMPNIISSISFAQ 202
            :|.....|:        |..||.|   ..:.:|..|.:    :...|.:.|.:| ....:::...
  Fly   136 NCPNFNCFV--------IQKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCLM-EFSLNLNIMH 191

  Fly   203 YY---LLLQGIAWRQRRLTEGLERELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSILLL 264
            |:   ||:....|......:.|..:|........|.:.:....:..|::..:.:...::|. :.|
  Fly   192 YHVGVLLIYRYVWLINEQLKDLVSQLKLNPETDFSRIHQFLSLYKRLLELNRKLVIAYEYQ-MTL 255

  Fly   265 FVGCFLNFNLVL--FLVYQGIENPSMA---------------DFTKWVCMLLWLAMHVGKVCSIL 312
            |:...|:.|:|:  ||:..|:...:.:               ||  |:|:         ..|.: 
  Fly   256 FIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLINIWDF--WLCI---------AACDL- 308

  Fly   313 HFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVAS 377
              .:...:|.:..|.:.|.:.:....::.::..|.........:..:||:.:::.:....:::.:
  Fly   309 --TEKAGDETAIILKIFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMNCRMGFKMIITT 371

  Fly   378 ADFFIFLLQYD 388
            ..:.::|:|:|
  Fly   372 FLYLVYLVQFD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 59/369 (16%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 70/401 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.