DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr36a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:301 Identity:64/301 - (21%)
Similarity:111/301 - (36%) Gaps:85/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 YTIDCNRTKRFIRLQ---LFLVGI--FACLAIFFNIWTHKF---VVYRSILSINSYVMPNIISSI 198
            :.||..| .|.:..|   ||.:.|  ..|:.:...| :.||   |.:.....::.||   ||..:
  Fly    24 FEIDWQR-GRVVAAQRGILFAIAINVLICMVLLLQI-SKKFNLDVYFGRANQLHQYV---IIVMV 83

  Fly   199 SFAQYYLLLQGIA-----WRQR----RLTEGLERELTHLHSPRISEVQK---------------- 238
            |..    :..||:     ||||    ||.|.:.|  ..|..|.:.::.:                
  Fly    84 SLR----MASGISAILNRWRQRAQLMRLVECVLR--LFLKKPHVKQMSRWAILVKFSVGVVSNFL 142

  Fly   239 ---IRMHHANLIDFTKAVNRT-------------FQYSILLLFVGCFLNFNLVLFLVYQGIEN-- 285
               |.|...:.:.|.:.|...             .|:.:::|||..:  ::|:...|.|.|..  
  Fly   143 QMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHYLVILFVRAY--YHLLKTEVRQAIHESQ 205

  Fly   286 ------PSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTIT 344
                  |..|.|....|   :||..:..:.       .:||:..:.:|.|::| :..:.|.....
  Fly   206 MLSEIYPRRAAFMTKCC---YLADRIDNIA-------KLQNQLQSIVTQLNQV-FGIQGIMVYGG 259

  Fly   345 HFIIQMRTNVRQH--VVCGVINLDLKFLTTLLVASADFFIF 383
            ::|..:.|....:  .:.|:..|.|......||.|  :|:|
  Fly   260 YYIFSVATTYITYSLAINGIEELHLSVRAAALVFS--WFLF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 64/301 (21%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 64/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.