DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr36b

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:282 Identity:51/282 - (18%)
Similarity:108/282 - (38%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 YTIDCNRTKRFIR-----LQLFLVGIFACLAIFFNIWTH--KFVVYRSILSINSYVMPNIISSIS 199
            :..|| ||.|..:     :..|:..||..:.|.:|...|  ..::::|...::.||: .|:|.:.
  Fly    24 FEFDC-RTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANKLHEYVI-IIMSGLK 86

  Fly   200 FAQYYLLLQGI-----AWRQRRLTEGLERELTHLH--SPRISEVQKIRMHHANLIDFTKAVNRTF 257
                  ::.|:     .|.||.....|.:::..|:  :|::..:                    .
  Fly    87 ------IVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSM--------------------I 125

  Fly   258 QYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEH 322
            ::.|||   ..|::|.:.|..|...::........:.:.:|:       |:|.....|.:| ::|
  Fly   126 RWGILL---KAFISFAIELLQVTLSVDALDRQGTAEMMGLLV-------KLCVSFIMNLAI-SQH 179

  Fly   323 STCLTLLSRVSY------ARKDIQDTITHFIIQMRT------------------NVRQHVVCGVI 363
            ...: ||.|..|      .|..|:::.....:|:|.                  .|:..:...|.
  Fly   180 FLVI-LLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVG 243

  Fly   364 NLDLKFLTTLLVASADFFIFLL 385
            .||..|....|:|.:::::.::
  Fly   244 QLDEVFGMQGLMAYSEYYLSIV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 51/282 (18%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 51/282 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.