DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr36c

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:415 Identity:77/415 - (18%)
Similarity:145/415 - (34%) Gaps:131/415 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILWYGLFVLGSYWEFVLVTTQRVSLDR----YLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTN 132
            :.:||||:..|.:||.. .|.||...:    |..|::|.|:.::|:          :|...  ||
  Fly    11 VYYYGLFIGLSNFEFDW-NTGRVFTKKWSTLYAIALDSCIFALYIY----------HWTGN--TN 62

  Fly   133 IVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWT-------------------HKFV 178
            ||.:...||.           .|..::|.|...|.|...::|                   ..:|
  Fly    63 IVNAIFGRAN-----------MLHEYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYV 116

  Fly   179 VYRSILS------INSYVMPNIISSISFA-----------QYYL---------LLQGIAWRQR-- 215
            ....:..      :..::..:|...:..|           |:||         ::..:|..|:  
  Fly   117 ARPQVRRMSRWGILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQHM 181

  Fly   216 --------------RLTEGLERELTHLHSPR------------ISEVQKIRMHHANLIDFTKAVN 254
                          .|.:.::.....|.|||            ..:::.|....:.|......:.
  Fly   182 IMLFVRTQFQLINTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQME 246

  Fly   255 RTFQYSILLLFVGCFLNFNLVLFLVY----QGIENPSMADFT-----KWVCMLLWLAMHVGKVCS 310
            ..|.....:.:.|.:|:.....:|.|    .|.||.||...|     .| |...:|...: .:..
  Fly   247 EVFGIQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSW-CFFYYLDGML-NLSV 309

  Fly   311 ILHFNQSIQNEHSTCLTLL-SRVSYARKDI--QDTITHFIIQMRTNVRQHVVCGVINL-DLKFLT 371
            :||    :|:::...|.:| .|..:...|:  ::...:..:|:   :|..:...|:.| |:....
  Fly   310 MLH----VQDDYWEMLQILGKRTIFVGLDVRLEEAFENLNLQL---IRNPLKITVVKLYDVTRSN 367

  Fly   372 TL-----LVASADFFIFLLQYDVTY 391
            |:     |:..:   |||:|||:.:
  Fly   368 TMAMFGNLITHS---IFLIQYDIEH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 75/410 (18%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 77/413 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.