DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr77a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster


Alignment Length:426 Identity:83/426 - (19%)
Similarity:144/426 - (33%) Gaps:149/426 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YRLVHLSWMILWYGLFVLGSYWEFVLVTTQRVSL---DRYLNAIESAIYVVHIFSIMLLTW---- 120
            |..:|...|:::.|.|...::|    ...||::.   :|.|..|....||:.:....:..|    
  Fly    68 YLRIHGCVMLIFVGCFSPFAFW----CIFQRMAFLRQNRILLMIGFNRYVLLLVCAFMTLWIHCF 128

  Fly   121 -------------QCRNWAPKLMTNIVTSDLNRAYTIDCNRTKR-----FIRLQLFLVG------ 161
                         :||....:||......|     ::||..||.     .:.|..:|:.      
  Fly   129 KQAEIIGCLNRLLKCRRRLRRLMHTRKLKD-----SMDCLATKGHLLEVVVLLSSYLLSMAQPIQ 188

  Fly   162 ------------IFACLAIFFNIWTHKFVVYRSI--LSINSYVMPNIISSISFAQYYLLLQGIA- 211
                        ::||..:|.:       |.::|  ||:..|.|..:..........|||..|. 
  Fly   189 ILKDDPEVRRNFMYACSLVFVS-------VCQAILQLSLGMYTMAILFLGHLVRHSNLLLAKILA 246

  Fly   212 --------------WRQRR-LTEGLER-------ELTHLHSPRISEVQKIRMHHANLIDFTKAVN 254
                          |..|: |.:|.::       .|.|:|.      |.:::|.:..        
  Fly   247 DAEHIFESSQKAGFWPNRQELYKGQQKWLALELWRLLHVHH------QLLKLHRSIC-------- 297

  Fly   255 RTFQYSILLLFVGCFLNF-----NLVLFLVYQGIENPSMADFTKWVCMLL------------WLA 302
                 |:..:...|||.|     .:.||..|          |.|:...:|            .:|
  Fly   298 -----SLCAVQAVCFLGFVPLECTIHLFFTY----------FMKYSKFILRKYGRSFPLNYFAIA 347

  Fly   303 MHVGKVCSIL-----------HFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQ 356
            ..||...::|           .||.:.:......|...||::.  |.::.|: ||......|| :
  Fly   348 FLVGLFTNLLLVILPTYYSERRFNCTREIIKGGGLAFPSRITV--KQLRHTM-HFYGLYLKNV-E 408

  Fly   357 HV----VCGVINLDLKFLTTLLVASADFFIFLLQYD 388
            ||    .||:..|:...|..::.|..::.:.|:|:|
  Fly   409 HVFAVSACGLFKLNNAILFCIVGAILEYLMILIQFD 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 82/424 (19%)
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 82/424 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.