DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr93c

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster


Alignment Length:265 Identity:57/265 - (21%)
Similarity:104/265 - (39%) Gaps:78/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VGIFACLA-IFFNIWT----H-KFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLT 218
            :.:||.|. ||..|.:    | .||.|.|:.::.|.|.       |||:..|         ||..
  Fly   171 LSLFATLCEIFLEIGSLMIIHIGFVGYLSVAALYSEVN-------SFARIEL---------RRQL 219

  Fly   219 EGLERELTHLHSPRISEVQKIRMHHA-NLIDFTKAVNRTF----QYSILLLFVG-----CFLNFN 273
            ..|||.:......:...:.:.|:... ::.|..:.|.|||    :..:|::.:|     ..|::.
  Fly   220 RSLERPVGGPVGRKQLRIVEYRVDECISVYDEIERVGRTFHRLLELPVLIILLGKIFATTILSYE 284

  Fly   274 LVL-------FLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQN--------EHS 323
            :::       .:...|:...|.||     .:||.||:|.....|.:....|::|        .|.
  Fly   285 VIIRPELYARKIGMWGLVVKSFAD-----VILLTLAVHEAVSSSRMMRRLSLENFPITDHKAWHM 344

  Fly   324 TCLTLLSRVSYARKDIQDTITHFIIQMRT----NVRQHVVCGVINLDLKFLTTLLVASADFFIFL 384
            .....|||:::           |..::|.    .|...|:       |.||::::.    :|.::
  Fly   345 KWEMFLSRLNF-----------FEFRVRPLGLFEVSNEVI-------LLFLSSMIT----YFTYV 387

  Fly   385 LQYDV 389
            :||.:
  Fly   388 VQYGI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 56/262 (21%)
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 57/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.