DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr22f

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:401 Identity:86/401 - (21%)
Similarity:153/401 - (38%) Gaps:89/401 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LFWLLL-----ISVLANTAPITILPGCPNRFYRLVHLSWMILWYGLFVLGSYWEFVLVTTQRVSL 96
            |.|.:|     .|.|....|.|.    .:|..:|....|::| || |||.|....:.:::...|.
  Fly    14 LAWFMLQTTLYASWLLGLFPFTF----DSRRKQLKRSRWLLL-YG-FVLHSLAMCLAMSSHLASK 72

  Fly    97 D-RYLNAIE-----SAIY----VVHIFSIMLL----TWQCRNWAPKLMTNIVTSD--------LN 139
            . |..||.|     ..||    |...|:|.:|    .|: .|...|:...::|.:        |.
  Fly    73 QRRKYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWK-SNTVRKIANELLTLEGQVKDLLTLK 136

  Fly   140 RAYTIDCNRTKRFI-RLQLFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMPNI---ISSISF 200
            .....:|...|:.: .:..|::.|:.||.        :...|..||.| ...:|::   :..:.|
  Fly   137 NCPNFNCFVIKKHVAAIGQFVISIYFCLC--------QENSYPKILKI-LCCLPSVGLQLIIMHF 192

  Fly   201 AQYYLLLQGIAWRQRRLTEGLERELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSILLLF 265
            ....:|:....|   .:.|.|| :..||.|.||..:..:......|.:...|.|..  ..||:|.
  Fly   193 HTEIILVYRYVW---LVNETLE-DSHHLSSSRIHALASLYDRLLKLSELVVACNDL--QLILMLI 251

  Fly   266 VGCFLNFNLVLFLVYQGIE----------NPSMA----DFTKW----VCMLLWLAMHVGKVCSIL 312
            :....|...:.||:..|:.          :|.:.    ||  |    ||.|      .|| |.  
  Fly   252 IYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFWDF--WLNIVVCDL------AGK-CG-- 305

  Fly   313 HFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVAS 377
                   ::.|..|.|.:.:.:..::::.::..|.........:..:||:.:::......:::.|
  Fly   306 -------DQTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITS 363

  Fly   378 ADFFIFLLQYD 388
            ..:.::|||:|
  Fly   364 FLYLVYLLQFD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 78/370 (21%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 84/396 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.