DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr28a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster


Alignment Length:455 Identity:83/455 - (18%)
Similarity:166/455 - (36%) Gaps:122/455 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERYKE---LYRTLFWLLLISVLANTAPITILPGCPNR---------FYRLVHLSWMILWYGLFV- 79
            ||:.:   :::.|..|..||:| ..||..:... |.:         |..:||..:.:|.:|:.| 
  Fly     7 ERFSQADNVFQALRPLTFISLL-GLAPFRLNLN-PRKEVQTSKFSFFAGIVHFLFFVLCFGISVK 69

  Fly    80 -----LGSYWEFVLVTTQRVSLDRYLNA---IESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTS 136
                 :|.:::        .::.|:.:.   :...:.:..||...:...|  .....:..|||..
  Fly    70 EGDSIIGYFFQ--------TNITRFSDGTLRLTGILAMSTIFGFAMFKRQ--RLVSIIQNNIVVD 124

  Fly   137 DL--NRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWTHKFVVYRSI---LSINSYVMPNIIS 196
            ::  .....:|..|    |.|..||:.:...|   ||      |:|..:   |.:::.:.|:.::
  Fly   125 EIFVRLGMKLDYRR----ILLSSFLISLGMLL---FN------VIYLCVSYSLLVSATISPSFVT 176

  Fly   197 SISFAQYYLLLQGIAWR-------------------QRRLTEGLER----ELTHLHS-------- 230
            ..:||..::.:..:.::                   |..|...:|:    ||:.:||        
  Fly   177 FTTFALPHINISLMVFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYS 241

  Fly   231 -----------PRISEVQKIRMH-----------HANLIDFTKAVNRTFQYSILLLFVGCFLNFN 273
                       .|.|....||::           |..|.|..:.:...|.|.:|.:....||...
  Fly   242 HRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFIL 306

  Fly   274 LVLFLVYQGIENPSMAD-------FTKWVCMLLWLAMHV-----GKVCSILHFNQSIQNEHSTCL 326
            ...|.:.:.|.||...|       |..::..|:|..:.:     |...:|||.:.:....|.   
  Fly   307 FDDFYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIVHK--- 368

  Fly   327 TLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQYDVTY 391
             :|:...  ..:::|.:....:|:..........|:..||...:.|:..|:..:.|.|:|:..|:
  Fly   369 -ILNITD--DPELRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRFTH 430

  Fly   392  391
              Fly   431  430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 72/414 (17%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 79/438 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.