DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr39b

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:340 Identity:65/340 - (19%)
Similarity:115/340 - (33%) Gaps:109/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ITILPGCPNRFYRLVHLSWMILWYGLF-VLGSYWEFVLVTTQRVSLDRYLNAIESAIYVVHIFSI 115
            :|:||.    .|..:..|.:..|..|. :|....:||||......|..:::.:  .|.:.::...
  Fly   132 VTVLPS----IYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLL--GIRLQNVLEC 190

  Fly   116 MLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWTHKFVVY 180
            .|:...|                    |:|.| ..|...|: ||:.:.........::||    :
  Fly   191 HLMGANC--------------------TLDGN-ANRLCSLE-FLLALKQSHMQLHYLFTH----F 229

  Fly   181 RSILS---INSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERELTHLHSPRISEVQKIRMH 242
            ..:..   :.:||   ::.|.|....|       |.|:.|.|..|.:                  
  Fly   230 NDLFGWSILGTYV---VLFSDSTVNIY-------WTQQVLVEVYEYK------------------ 266

  Fly   243 HANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLWLAMHVGK 307
                          :.|:...:||..|  ||:::|.        ...:|.:...:|      :|.
  Fly   267 --------------YLYATFSVFVPSF--FNILVFC--------RCGEFCQRQSVL------IGS 301

  Fly   308 VCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTT 372
            ....|..:.||..|          .||     :|.:..||:|:..||......|.::.|...|.:
  Fly   302 YLRNLSCHPSIGRE----------TSY-----KDLLMEFILQVEQNVLAINAEGFMSTDNSLLMS 351

  Fly   373 LLVASADFFIFLLQY 387
            :|.|...:.|.|:|:
  Fly   352 ILAAKVTYLIVLMQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 62/331 (19%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 65/340 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.