DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59f and Gr58a

DIOPT Version :9

Sequence 1:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster


Alignment Length:419 Identity:89/419 - (21%)
Similarity:160/419 - (38%) Gaps:109/419 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QYAERYKELYRTLFWLLLISVLANTAPITILP-GCPNRFYRLVHLSWMILWYGLFVLGSY----- 83
            |:...||:.     |.|:.:...:...:|:|| ..|:..|.                .||     
  Fly    24 QFLLGYKQR-----WYLIYTACLHGGLLTVLPFTFPHYMYD----------------DSYMSSNP 67

  Fly    84 ---WEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTID 145
               |.|.|....|               ::.:||.:||.|..|.....|..|::...| :..|:|
  Fly    68 VLKWTFNLTNITR---------------IMAMFSGVLLMWFRRKRILNLGENLILHCL-KCKTLD 116

  Fly   146 CNRTKRFIRLQ------LFLVGIFACLAIFFNIWTHKFVVYR--SILSINSYVMPNIISSIS-FA 201
             ||:|::.:|:      ||.:.:.|.|:|...    ..:::|  |:..|:...|  |::.|: |.
  Fly   117 -NRSKKYSKLRKRVRNVLFQMLLVANLSILLG----ALILFRIHSVQRISKTAM--IVAHITQFI 174

  Fly   202 QYYLLLQGIA-------WRQRRLTEGLERELTHL-HSPR----------------ISEVQKIRMH 242
            ....::.||.       |:..||...|:...:.| |..|                ::::.|:...
  Fly   175 YVVFMMTGICVILLVLHWQSERLQIALKDLCSFLNHEERNSLTLSENKANRSLGKLAKLFKLFAE 239

  Fly   243 HANLIDFTKAVNRTFQYSILLLFVGCFL-NFNLVLFLVYQGIENPSMADFTK----WVCML-LWL 301
            :..|:   :.|.|||...|.||.:..|: |.|||...|..|.:....:.:|:    ||.:. .|.
  Fly   240 NQRLV---REVFRTFDLPIALLLLKMFVTNVNLVYHGVQFGNDTIETSSYTRIVGQWVVISHYWS 301

  Fly   302 AMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLD 366
            |:.:..|...:.....:  :....|...|.:...::|....:..|...:|.:...:.|||:    
  Fly   302 AVLLMNVVDDVTRRSDL--KMGDLLREFSHLELVKRDFHLQLELFSDHLRCHPSTYKVCGL---- 360

  Fly   367 LKFLTTLLVASADFF------IFLLQYDV 389
              |:.....:.|.||      :.|:|:|:
  Fly   361 --FIFNKQTSLAYFFYVLVQVLVLVQFDL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 79/379 (21%)
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 84/403 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.