DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gdl and Dgcr6

DIOPT Version :9

Sequence 1:NP_001027127.1 Gene:gdl / 3772583 FlyBaseID:FBgn0001099 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_006248671.1 Gene:Dgcr6 / 303794 RGDID:1309390 Length:201 Species:Rattus norvegicus


Alignment Length:181 Identity:67/181 - (37%)
Similarity:105/181 - (58%) Gaps:16/181 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QRKIYFLVDQLRTYHSELPENLQTRISYDLLTELANCVLNDGIFVIVKALMELQHETERHLIKIR 94
            |.:.|.|:..|::...|||.:.|.|:||..|::||..:|:..:|.||:.|:|:||.||:.|...|
  Rat    18 QERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQR 82

  Fly    95 MQAENEYEIEVAEWRSK-IKDPEELR-HILGLMKIKHTKKL--------------HESDTKIIEI 143
            ::.:||:.:.....|.| ::..:..| |.|.:::....::|              ...|.||:..
  Rat    83 LRLQNEHRVLRQTLRQKHLEAQQSCRPHNLPVLQAAQQRELEPWQALEHRIREEQQAMDRKIVLE 147

  Fly   144 LDQKVNDQQSTLQKAGVPGFYVTENPKEIKIQMFLLDFILRLSRLKYEPGK 194
            ||:||.||||||:||||.|||||.||:|:.:||.||:.|.:|.:...:.||
  Rat   148 LDRKVADQQSTLEKAGVAGFYVTTNPQELTLQMNLLELIRKLQQRGCQMGK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdlNP_001027127.1 DGCR6 29..194 CDD:284689 65/179 (36%)
Dgcr6XP_006248671.1 DGCR6 9..198 CDD:369318 65/179 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338515
Domainoid 1 1.000 110 1.000 Domainoid score I6199
eggNOG 1 0.900 - - E1_KOG4810
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4152
Inparanoid 1 1.050 109 1.000 Inparanoid score I4798
OMA 1 1.010 - - QHG48814
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007511
OrthoInspector 1 1.000 - - oto96844
orthoMCL 1 0.900 - - OOG6_106863
Panther 1 1.100 - - LDO PTHR13054
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5642
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.