DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gdl and LOC102724770

DIOPT Version :9

Sequence 1:NP_001027127.1 Gene:gdl / 3772583 FlyBaseID:FBgn0001099 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001355171.1 Gene:LOC102724770 / 102724770 -ID:- Length:220 Species:Homo sapiens


Alignment Length:178 Identity:66/178 - (37%)
Similarity:104/178 - (58%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QRKIYFLVDQLRTYHSELPENLQTRISYDLLTELANCVLNDGIFVIVKALMELQHETERHLIKIR 94
            |.:.|.|:..|::...|||.:.|.|:||..|::||..:|:..:|.||:.|:|:||.||:.|...|
Human    18 QERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQR 82

  Fly    95 MQAENEYEIEVAEWRSKIKDPEEL--RHILGLMKIKHTKKL-----------HESDTKIIEILDQ 146
            ::.:||:.:.....|.|.::.::.  .|.|.:::....::|           ...|.||:..||:
Human    83 LRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDR 147

  Fly   147 KVNDQQSTLQKAGVPGFYVTENPKEIKIQMFLLDFILRLSRLKYEPGK 194
            ||.||||||:||||.|||||.||:|:.:||.||:.|.:|.:.....||
Human   148 KVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdlNP_001027127.1 DGCR6 29..194 CDD:284689 64/176 (36%)
LOC102724770NP_001355171.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144818
Domainoid 1 1.000 109 1.000 Domainoid score I6360
eggNOG 1 0.900 - - E1_KOG4810
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4891
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48814
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007511
OrthoInspector 1 1.000 - - otm41190
orthoMCL 1 0.900 - - OOG6_106863
Panther 1 1.100 - - LDO PTHR13054
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10740
SonicParanoid 1 1.000 - - X5642
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.