DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gdl and dgcr6

DIOPT Version :9

Sequence 1:NP_001027127.1 Gene:gdl / 3772583 FlyBaseID:FBgn0001099 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_002932120.1 Gene:dgcr6 / 100125791 XenbaseID:XB-GENE-998943 Length:198 Species:Xenopus tropicalis


Alignment Length:183 Identity:60/183 - (32%)
Similarity:109/183 - (59%) Gaps:18/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YQQP---TPEFLQRKIYFLVDQLRTYHSELPENLQTRISYDLLTELANCVLNDGIFVIVKALMEL 82
            |::|   |.:  |.:.|:|:.:|::...:||.:.|.|:|:.:|::||..:::..:|.||:.|:|:
 Frog     8 YEEPRDITQQ--QERHYYLLSELQSLVKDLPSSCQQRMSHTILSDLALALIDGTVFEIVQGLLEI 70

  Fly    83 QHETERHLIKIRMQAENEYEIEVAEWRSKIKDPEE--LRHILGLMKIKHTKKLHE---------- 135
            ||.||::|...|::...|:.....:...|.::.::  ..|...::|....::|..          
 Frog    71 QHLTEKNLYNQRLKLHAEHRGLKQDLLRKHREAQQSCKAHNFQVLKATQQRELESLEQRIKEEQR 135

  Fly   136 -SDTKIIEILDQKVNDQQSTLQKAGVPGFYVTENPKEIKIQMFLLDFILRLSR 187
             .|.||:..|||||.|||:||:||||.|||:|:||:|:.:||.:|:.|.:|.:
 Frog   136 MMDEKIVLELDQKVIDQQTTLEKAGVSGFYITKNPQELMLQMNILELIQKLQQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdlNP_001027127.1 DGCR6 29..194 CDD:284689 57/172 (33%)
dgcr6XP_002932120.1 DGCR6 9..195 CDD:369318 59/182 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7080
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I4892
OMA 1 1.010 - - QHG48814
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007511
OrthoInspector 1 1.000 - - oto103545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5642
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.