DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33858 and zgc:110425

DIOPT Version :9

Sequence 1:NP_001027374.1 Gene:His1:CG33858 / 3772581 FlyBaseID:FBgn0053858 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001018582.1 Gene:zgc:110425 / 553782 ZFINID:ZDB-GENE-050522-103 Length:195 Species:Danio rerio


Alignment Length:209 Identity:84/209 - (40%)
Similarity:107/209 - (51%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TKA--KKASATP---SHPPTQQMVDASIKNLKERGGSSLLAIKKYITA-TYKCDAQKLAPFIKKY 93
            |||  ||.:|.|   :.|...:::..::...|||.|.||.|:||.::| .|  |.:|....:|..
Zfish     6 TKAAKKKPAAKPKKRTGPSVSELIVKAVSASKERSGVSLPALKKALSAGGY--DVEKNNSRVKIA 68

  Fly    94 LKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTA 158
            :|:.|:.|.|.||||.||||||||:....:.|...|| |.....||..:||.|:||         
Zfish    69 IKALVLKGDLKQTKGIGASGSFKLNKKPAETKTKPAK-KAAPKAKKPAAKKPAAKK--------- 123

  Fly   159 VGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVIAKASKA 223
             .||.|||||.|..|.||:.  ||..|...|..|     |:|..||..|...:..||..||...|
Zfish   124 -PAAAKKPKAAKKPAAKKSP--KKPAKKATKSPK-----KAKKPATPKKAAKSPKKAKAAKPKAA 180

  Fly   224 KPAVSAKPKKTVKK 237
            ||. :||||||..|
Zfish   181 KPK-AAKPKKTAAK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33858NP_001027374.1 Linker_histone 46..118 CDD:278939 30/72 (42%)
zgc:110425NP_001018582.1 Linker_histone 23..93 CDD:278939 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.