DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33858 and H1f10

DIOPT Version :9

Sequence 1:NP_001027374.1 Gene:His1:CG33858 / 3772581 FlyBaseID:FBgn0053858 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_575600.1 Gene:H1f10 / 500252 RGDID:1565596 Length:192 Species:Rattus norvegicus


Alignment Length:243 Identity:68/243 - (27%)
Similarity:98/243 - (40%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVE---KKVVQKKASGSAG-TKAKKASATPSHPPTQ--QMVDASIKNLKERGGSSLLAIK 72
            |.||.:.:   :|..  ||||||. |:.|:......:.|.:  |:|..:|:.|.|||||||..|.
  Rat     8 ALPPTSADGTARKTA--KASGSAAPTQPKRRKNRKKNQPGKYSQLVVETIRKLGERGGSSLARIY 70

  Fly    73 KYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAE 137
            .........|.|....::|..:::.|.|..|:|.||.||:|||||:                  .
  Rat    71 AEARKVAWFDQQNGRTYLKYSIRALVQNDTLLQVKGTGANGSFKLN------------------R 117

  Fly   138 KKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPA 202
            ||::         |.:.|:.|..|:...|||:.|                              |
  Rat   118 KKLE---------GSAEKRGASAASSPAPKARTA------------------------------A 143

  Fly   203 ATKAKVTAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKKPKAK 250
            |..|..|.|:|:.........|.|.:|...|.||||:..:..|.||.:
  Rat   144 AAAADRTPARPQPERRAQKSKKAAAAAASTKKVKKAAKPSVPKVPKGR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33858NP_001027374.1 Linker_histone 46..118 CDD:278939 28/73 (38%)
H1f10XP_575600.1 Linker_histone 46..116 CDD:278939 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.