DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33858 and His1:CG33822

DIOPT Version :10

Sequence 1:NP_001027374.1 Gene:His1:CG33858 / 3772581 FlyBaseID:FBgn0053858 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001027314.1 Gene:His1:CG33822 / 3772665 FlyBaseID:FBgn0053822 Length:256 Species:Drosophila melanogaster


Alignment Length:164 Identity:29/164 - (17%)
Similarity:57/164 - (34%) Gaps:46/164 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 QLMRVLDL--HGVEFGGELPSSIGLLIHLRYLSLYRAKASHLPSSMQNLKMLLYLNLCVQESCYI 631
            ::|.:.||  |...:|....:.|.:|||:.::                ..:...:.|.:..|..|
  Fly     3 RIMGLFDLEKHFAFYGAYHSNPINILIHIIFV----------------WPIFFSVLLLLHSSTPI 51

  Fly   632 YIPNFLKEMLELKYLSLPLRMDDKVKLELGNL---------VNLEKLENFSTEHGGVGDLQFMTR 687
            :.|:.|.       .|..|.:|..::..:|.:         :.|:|...            |:..
  Fly    52 FDPSQLG-------FSQSLTLDGVLRFNVGFIFALIYALFYIGLDKKSG------------FVAA 97

  Fly   688 LRALSIYIRGRLNMKTLSSSLSKLRDLENLTICY 721
            |...|.::........|.|||:....|.:..:|:
  Fly    98 LMCFSCWVGSSFLAVRLGSSLALKVGLASQLLCW 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33858NP_001027374.1 H15 43..130 CDD:238028
His1:CG33822NP_001027314.1 H15 43..130 CDD:238028 19/105 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.