DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33858 and H1-6

DIOPT Version :9

Sequence 1:NP_001027374.1 Gene:His1:CG33858 / 3772581 FlyBaseID:FBgn0053858 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005314.2 Gene:H1-6 / 3010 HGNCID:4720 Length:207 Species:Homo sapiens


Alignment Length:219 Identity:74/219 - (33%)
Similarity:106/219 - (48%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::..|.|||   |..|.:||...:|:....||..:  ||....:....:::..::...:||.|
Human     1 MSETVPAASAS---AGVAAMEKLPTKKRGRKPAGLIS--ASRKVPNLSVSKLITEALSVSQERVG 60

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLS---------AS 120
            .||:|:||.:.|. |  |.:|....||..|||.|..|.|:||:|.|||||||||         :.
Human    61 MSLVALKKALAAAGY--DVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSK 123

  Fly   121 AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEK 185
            |||....|.|..|||.:.|              |.|||  ..:|:.|..:|...|.....:|.:.
Human   124 AKKSVSAKTKKLVLSRDSK--------------SPKTA--KTNKRAKKPRATTPKTVRSGRKAKG 172

  Fly   186 AKAKDAKKTGIIKSKPAATKAKVT 209
            ||.|..:|:.:   |..|:|:|:|
Human   173 AKGKQQQKSPV---KARASKSKLT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33858NP_001027374.1 Linker_histone 46..118 CDD:278939 30/72 (42%)
H1-6NP_005314.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 11/32 (34%)
H15 43..126 CDD:238028 33/84 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..207 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10654
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.