DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33858 and H1f6

DIOPT Version :9

Sequence 1:NP_001027374.1 Gene:His1:CG33858 / 3772581 FlyBaseID:FBgn0053858 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_034507.2 Gene:H1f6 / 107970 MGIID:1888530 Length:209 Species:Mus musculus


Alignment Length:240 Identity:84/240 - (35%)
Similarity:113/240 - (47%) Gaps:48/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPP----TQQMVDASIKNLK 61
            ||::|.|.|::.|   ||.||:|...|:       :.||....|:..|    ..:::..::...:
Mouse     1 MSETAPAASSTLV---PAPVEEKPSSKR-------RGKKPGLAPARKPRGFSVSKLIPEALSTSQ 55

  Fly    62 ERGGSSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEK 125
            ||.|.||.|:||.:.|. |  |.:|....||..||..|..|.|:||||.|||||||||..|....
Mouse    56 ERAGMSLAALKKALAAAGY--DVEKNNSRIKLALKRLVNKGVLVQTKGTGASGSFKLSKKAASGN 118

  Fly   126 DPKAKSKVLSAEKKVQSKKVASKKIGV--------SSKKTAVGAADKKPKAKKAVATKKTAENKK 182
            | |.|.|        :|....:||:|:        |||..||    |||   ||..||.:...:|
Mouse   119 D-KGKGK--------KSASAKAKKMGLPRASRSPKSSKTKAV----KKP---KATPTKASGSGRK 167

  Fly   183 TEKAKAKDAKKTGIIKSKPA-ATKAKVTAAKPKAVIAKASKAKPA 226
            |:.||....:|:      || |..|...:.|.|.|:.|....|.|
Mouse   168 TKGAKGVQQRKS------PAKARAANPNSGKAKMVMQKTDLRKAA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33858NP_001027374.1 Linker_histone 46..118 CDD:278939 31/76 (41%)
H1f6NP_034507.2 H15 37..117 CDD:238028 34/81 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..209 50/133 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10384
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.